Lineage for d1cg7a_ (1cg7 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46275Fold a.21: HMG-box [47094] (1 superfamily)
  4. 46276Superfamily a.21.1: HMG-box [47095] (1 family) (S)
  5. 46277Family a.21.1.1: HMG-box [47096] (7 proteins)
  6. 46298Protein NHP6a [47102] (1 species)
  7. 46299Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47103] (1 PDB entry)
  8. 46300Domain d1cg7a_: 1cg7 A: [16428]

Details for d1cg7a_

PDB Entry: 1cg7 (more details)

PDB Description: hmg protein nhp6a from saccharomyces cerevisiae

SCOP Domain Sequences for d1cg7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cg7a_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae)}
mvtprepkkrttrkkkdpnapkralsaymffanenrdivrsenpditfgqvgkklgekwk
altpeekqpyeakaqadkkryesekelynatla

SCOP Domain Coordinates for d1cg7a_:

Click to download the PDB-style file with coordinates for d1cg7a_.
(The format of our PDB-style files is described here.)

Timeline for d1cg7a_: