Lineage for d1cg7a_ (1cg7 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697956Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2697957Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2697958Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 2697985Protein NHP6a [47102] (1 species)
  7. 2697986Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47103] (3 PDB entries)
  8. 2697988Domain d1cg7a_: 1cg7 A: [16428]

Details for d1cg7a_

PDB Entry: 1cg7 (more details)

PDB Description: hmg protein nhp6a from saccharomyces cerevisiae
PDB Compounds: (A:) protein (non histone protein 6 a)

SCOPe Domain Sequences for d1cg7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cg7a_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvtprepkkrttrkkkdpnapkralsaymffanenrdivrsenpditfgqvgkklgekwk
altpeekqpyeakaqadkkryesekelynatla

SCOPe Domain Coordinates for d1cg7a_:

Click to download the PDB-style file with coordinates for d1cg7a_.
(The format of our PDB-style files is described here.)

Timeline for d1cg7a_: