Lineage for d2f89f_ (2f89 F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2344488Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2344489Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2344490Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 2344555Protein automated matches [190489] (5 species)
    not a true protein
  7. 2344556Species Human (Homo sapiens) [TaxId:9606] [187688] (85 PDB entries)
  8. 2344634Domain d2f89f_: 2f89 F: [164275]
    automated match to d1fpsa_
    complexed with 210, mn, po4

Details for d2f89f_

PDB Entry: 2f89 (more details), 2.6 Å

PDB Description: crystal structure of human fpps in complex with pamidronate
PDB Compounds: (F:) Farnesyl Diphosphate Synthase

SCOPe Domain Sequences for d2f89f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f89f_ a.128.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
ldlpavflqyeedsyshimalieqyaaplppavflglarkiykrrk

SCOPe Domain Coordinates for d2f89f_:

Click to download the PDB-style file with coordinates for d2f89f_.
(The format of our PDB-style files is described here.)

Timeline for d2f89f_: