SCOPe 2.06: Domain d2f7kb1: 2f7k B:-4-312

Lineage for d2f7kb1 (2f7k B:-4-312)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.5: PfkB-like kinase [82515] (3 proteins)
   includes a variety of carbohydrate and pyrimidine kinases

6. Protein automated matches [190479] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187406] (10 PDB entries)

8. Domain d2f7kb1: 2f7k B:-4-312 [164273]
   Other proteins in same PDB: d2f7ka2, d2f7kb2
   automated match to d1rfua_

Details for d2f7kb1

PDB Entry: 2f7k, 2.8 Å

PDB Description: Crystal Structure of Human Pyridoxal Kinase

PDB Compounds: (B:) Pyridoxal kinase

SCOPe Domain Sequences for d2f7kb1:

Sequence; same for both SEQRES and ATOM records:

>d2f7kb1 c.72.1.5 (B:-4-312) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egvrtmeeecrvlsiqshvirgyvgnraatfplqvlgfeidavnsvqfsnhtgyahwkgq
vlnsdelqelyeglrlnnmnkydyvltgytrdksflamvvdivqelkqqnprlvyvcdpv
lgdkwdgegsmyvpedllpvykekvvpladiitpnqfeaellsgrkihsqeealrvmdml
hsmgpdtvvitssdlpspqgsnylivlgsqrrrnpagsvvmerirmdirkvdavfvgtgd
lfaamllawthkhpnnlkvacektvstlhhvlqrtiqcakaqagegvrpspmqlelrmvq
skrdiedpeivvqatvl

Timeline for d2f7kb1:

• d2f7kb1 first appeared in SCOPe 2.01, called d2f7kb_
  
• d2f7kb1 was called d2f7kb_ in SCOPe 2.05
  
• d2f7kb1 appears in SCOPe 2.07
  
• d2f7kb1 appears in the current release, SCOPe 2.08