SCOPe 2.01: Domain d2f7kb_: 2f7k B:

Lineage for d2f7kb_ (2f7k B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.5: PfkB-like kinase [82515] (3 proteins)
   includes a variety of carbohydrate and pyrimidine kinases

6. Protein automated matches [190479] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187406] (8 PDB entries)

8. Domain d2f7kb_: 2f7k B: [164273]
   automated match to d1rfua_

Details for d2f7kb_

PDB Entry: 2f7k, 2.8 Å

PDB Description: Crystal Structure of Human Pyridoxal Kinase

PDB Compounds: (B:) Pyridoxal kinase

SCOPe Domain Sequences for d2f7kb_:

Sequence; same for both SEQRES and ATOM records:

>d2f7kb_ c.72.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hhhhhhegvrtmeeecrvlsiqshvirgyvgnraatfplqvlgfeidavnsvqfsnhtgy
ahwkgqvlnsdelqelyeglrlnnmnkydyvltgytrdksflamvvdivqelkqqnprlv
yvcdpvlgdkwdgegsmyvpedllpvykekvvpladiitpnqfeaellsgrkihsqeeal
rvmdmlhsmgpdtvvitssdlpspqgsnylivlgsqrrrnpagsvvmerirmdirkvdav
fvgtgdlfaamllawthkhpnnlkvacektvstlhhvlqrtiqcakaqagegvrpspmql
elrmvqskrdiedpeivvqatvl

Timeline for d2f7kb_:

• d2f7kb_ is new in SCOPe 2.01-stable
  
• d2f7kb_ appears in SCOPe 2.02
  
• d2f7kb_ appears in the current release, SCOPe 2.08, called d2f7kb1