Lineage for d1hmaa_ (1hma A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310163Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2310164Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2310165Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 2310183Protein HMG-D [47100] (1 species)
  7. 2310184Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47101] (3 PDB entries)
  8. 2310188Domain d1hmaa_: 1hma A: [16427]

Details for d1hmaa_

PDB Entry: 1hma (more details)

PDB Description: the solution structure and dynamics of the dna binding domain of hmg-d from drosophila melanogaster
PDB Compounds: (A:) hmg-d

SCOPe Domain Sequences for d1hmaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hmaa_ a.21.1.1 (A:) HMG-D {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sdkpkrplsaymlwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd
dydravkefeang

SCOPe Domain Coordinates for d1hmaa_:

Click to download the PDB-style file with coordinates for d1hmaa_.
(The format of our PDB-style files is described here.)

Timeline for d1hmaa_: