SCOPe 2.08: Domain d1hmaa_: 1hma A:

Lineage for d1hmaa_ (1hma A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.1: HMG-box [47096] (10 proteins)

6. Protein HMG-D [47100] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47101] (3 PDB entries)

8. Domain d1hmaa_: 1hma A: [16427]

Details for d1hmaa_

PDB Entry: 1hma

PDB Description: the solution structure and dynamics of the dna binding domain of hmg-d from drosophila melanogaster

PDB Compounds: (A:) hmg-d

SCOPe Domain Sequences for d1hmaa_:

Sequence; same for both SEQRES and ATOM records:

>d1hmaa_ a.21.1.1 (A:) HMG-D {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sdkpkrplsaymlwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd
dydravkefeang

Timeline for d1hmaa_:

• d1hmaa_ first appeared (with stable ids) in SCOP 1.55, called d1hma__
  
• d1hmaa_ appears in SCOPe 2.07