| Class b: All beta proteins [48724] (178 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein alpha-Spectrin, SH3 domain [50058] (1 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [50059] (38 PDB entries) |
| Domain d2f2wa_: 2f2w A: [164263] automated match to d1pwta_ complexed with so4; mutant |
PDB Entry: 2f2w (more details), 1.7 Å
SCOPe Domain Sequences for d2f2wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2wa_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
elvlalydyqekspaevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld
Timeline for d2f2wa_: