Lineage for d1qrvb_ (1qrv B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311321Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2311322Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2311323Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 2311341Protein HMG-D [47100] (1 species)
  7. 2311342Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47101] (3 PDB entries)
  8. 2311344Domain d1qrvb_: 1qrv B: [16426]
    protein/DNA complex; complexed with na

Details for d1qrvb_

PDB Entry: 1qrv (more details), 2.2 Å

PDB Description: crystal structure of the complex of hmg-d and dna
PDB Compounds: (B:) high mobility group protein d

SCOPe Domain Sequences for d1qrvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrvb_ a.21.1.1 (B:) HMG-D {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dkpkrplsaymlwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakdd
ydravkefean

SCOPe Domain Coordinates for d1qrvb_:

Click to download the PDB-style file with coordinates for d1qrvb_.
(The format of our PDB-style files is described here.)

Timeline for d1qrvb_: