SCOPe 2.08: Domain d1qrvb_: 1qrv B:

Lineage for d1qrvb_ (1qrv B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.1: HMG-box [47096] (10 proteins)

6. Protein HMG-D [47100] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47101] (3 PDB entries)

8. Domain d1qrvb_: 1qrv B: [16426]
   protein/DNA complex; complexed with na

Details for d1qrvb_

PDB Entry: 1qrv, 2.2 Å

PDB Description: crystal structure of the complex of hmg-d and dna

PDB Compounds: (B:) high mobility group protein d

SCOPe Domain Sequences for d1qrvb_:

Sequence; same for both SEQRES and ATOM records:

>d1qrvb_ a.21.1.1 (B:) HMG-D {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dkpkrplsaymlwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakdd
ydravkefean

Timeline for d1qrvb_:

• d1qrvb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qrvb_ appears in SCOPe 2.07