![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.21.1: HMG-box [47095] (2 families) ![]() |
![]() | Family a.21.1.1: HMG-box [47096] (10 proteins) |
![]() | Protein HMG-D [47100] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47101] (3 PDB entries) |
![]() | Domain d1qrva_: 1qrv A: [16425] protein/DNA complex; complexed with na |
PDB Entry: 1qrv (more details), 2.2 Å
SCOPe Domain Sequences for d1qrva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qrva_ a.21.1.1 (A:) HMG-D {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} sdkpkrplsaymlwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd dydravkefeang
Timeline for d1qrva_: