SCOP 1.65: Domain d1hsn__: 1hsn -

Lineage for d1hsn__ (1hsn -)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (1 family)

5. Family a.21.1.1: HMG-box [47096] (8 proteins)

6. Protein HMG1, domains A and B [47097] (2 species)

7. Species Hamster (Cricetulus griseus) [TaxId:10029] [47099] (4 PDB entries)

8. Domain d1hsn__: 1hsn - [16424]
   domain B
   complexed with bme

Details for d1hsn__

PDB Entry: 1hsn

PDB Description: the structure of the hmg box and its interaction with dna

SCOP Domain Sequences for d1hsn__:

Sequence; same for both SEQRES and ATOM records:

>d1hsn__ a.21.1.1 (-) HMG1, domains A and B {Hamster (Cricetulus griseus)}
napkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekkaaklk
ekyekdiaayrakgkpdaa

Timeline for d1hsn__:

• d1hsn__ first appeared (with stable ids) in SCOP 1.55
  
• d1hsn__ appears in SCOP 1.63
  
• d1hsn__ appears in SCOP 1.67
  
• d1hsn__ appears in the current release, SCOPe 2.08, called d1hsna_