Lineage for d1hsn__ (1hsn -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.21: HMG-box [47094] (1 superfamily) Superfamily a.21.1: HMG-box [47095] (1 family) 
Family a.21.1.1: HMG-box [47096] (7 proteins) 
Protein HMG1, domains A and B [47097] (2 species) 
Species Hamster (Cricetulus griseus) [TaxId:10029] [47099] (4 PDB entries) 
Domain d1hsn__: 1hsn - [16424]
Details for d1hsn__
PDB Entry: 1hsn (more details)
PDB Description: the structure of the hmg box and its interaction with dna
SCOP Domain Sequences for d1hsn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hsn__ a.21.1.1 (-) HMG1, domains A and B {Hamster (Cricetulus griseus)}
napkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekkaaklk
ekyekdiaayrakgkpdaa
SCOP Domain Coordinates for d1hsn__:
Click to download the PDB-style file with coordinates for d1hsn__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hsn__:
- d1hsn__ first appeared (with stable ids) in SCOP 1.55
- d1hsn__ appears in SCOP 1.59
- d1hsn__ appears in the current release, SCOPe 2.08, called d1hsna_
View in 3D