SCOPe 2.08: Domain d1hsna_: 1hsn A:

Lineage for d1hsna_ (1hsn A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.1: HMG-box [47096] (10 proteins)

6. Protein High mobility group protein 1, HMG1 [47097] (2 species)
   duplication: contains HMG-box domains

7. Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [47099] (5 PDB entries)

8. Domain d1hsna_: 1hsn A: [16424]
   domain B
   complexed with bme

Details for d1hsna_

PDB Entry: 1hsn

PDB Description: the structure of the hmg box and its interaction with dna

PDB Compounds: (A:) high mobility group protein 1

SCOPe Domain Sequences for d1hsna_:

Sequence; same for both SEQRES and ATOM records:

>d1hsna_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
napkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekkaaklk
ekyekdiaayrakgkpdaa

Timeline for d1hsna_:

• d1hsna_ first appeared (with stable ids) in SCOP 1.55, called d1hsn__
  
• d1hsna_ appears in SCOPe 2.07