![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.21.1: HMG-box [47095] (2 families) ![]() |
![]() | Family a.21.1.1: HMG-box [47096] (10 proteins) |
![]() | Protein High mobility group protein 1, HMG1 [47097] (2 species) duplication: contains HMG-box domains |
![]() | Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [47099] (5 PDB entries) |
![]() | Domain d1hsna_: 1hsn A: [16424] domain B complexed with bme |
PDB Entry: 1hsn (more details)
SCOPe Domain Sequences for d1hsna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hsna_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} napkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekkaaklk ekyekdiaayrakgkpdaa
Timeline for d1hsna_: