SCOPe 2.04: Domain d2f0oa_: 2f0o A:

Lineage for d2f0oa_ (2f0o A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family)

5. Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Staphylococcal nuclease [50201] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50202] (197 PDB entries)
   Uniprot P00644 89-223

8. Domain d2f0oa_: 2f0o A: [164239]
   automated match to d1joka_
   mutant

Details for d2f0oa_

PDB Entry: 2f0o, 1.9 Å

PDB Description: crystal structure of staphylococcal nuclease mutant v66i/i72v

PDB Compounds: (A:) staphylococcal nuclease

SCOPe Domain Sequences for d2f0oa_:

Sequence; same for both SEQRES and ATOM records:

>d2f0oa_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
ienakkvevefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhl
rkseaqakkeklniws

Timeline for d2f0oa_:

• d2f0oa_ first appeared in SCOPe 2.01
  
• d2f0oa_ appears in SCOPe 2.03
  
• d2f0oa_ appears in SCOPe 2.05
  
• d2f0oa_ appears in the current release, SCOPe 2.08