Lineage for d2f0ja_ (2f0j A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2049951Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 2049952Family b.40.1.1: Staphylococcal nuclease [50200] (2 protein domains)
    barrel, closed; n=5, S=10
  6. 2049953Protein Staphylococcal nuclease [50201] (1 species)
  7. 2049954Species Staphylococcus aureus [TaxId:1280] [50202] (258 PDB entries)
    Uniprot P00644 89-223
  8. 2050048Domain d2f0ja_: 2f0j A: [164234]
    automated match to d1joka_
    mutant

Details for d2f0ja_

PDB Entry: 2f0j (more details), 1.8 Å

PDB Description: crystal structure of staphylococcal nuclease mutant i72v
PDB Compounds: (A:) staphylococcal nuclease

SCOPe Domain Sequences for d2f0ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f0ja_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
enakkvevefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
kseaqakkeklniws

SCOPe Domain Coordinates for d2f0ja_:

Click to download the PDB-style file with coordinates for d2f0ja_.
(The format of our PDB-style files is described here.)

Timeline for d2f0ja_: