Lineage for d2ez2a_ (2ez2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131389Family c.67.1.2: Beta-eliminating lyases [53397] (3 protein domains)
  6. 2131419Protein automated matches [190632] (1 species)
    not a true protein
  7. 2131420Species Citrobacter freundii [TaxId:546] [187681] (8 PDB entries)
  8. 2131431Domain d2ez2a_: 2ez2 A: [164226]
    automated match to d1c7ga_
    complexed with k, po4

Details for d2ez2a_

PDB Entry: 2ez2 (more details), 1.85 Å

PDB Description: Apo tyrosine phenol-lyase from Citrobacter freundii at pH 8.0
PDB Compounds: (A:) tyrosine phenol-lyase

SCOPe Domain Sequences for d2ez2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ez2a_ c.67.1.2 (A:) automated matches {Citrobacter freundii [TaxId: 546]}
mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
myftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicl
avtvnlaggqpvsmanmravrelteahgikvfydatrcvenayfikeqeqgfenksiaei
vhemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdme
amaiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqde
fpaqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvv
adgiiklyqhkedirglkfiyepkqlrfftarfdyi

SCOPe Domain Coordinates for d2ez2a_:

Click to download the PDB-style file with coordinates for d2ez2a_.
(The format of our PDB-style files is described here.)

Timeline for d2ez2a_: