Lineage for d1nhm__ (1nhm -)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151015Fold a.21: HMG-box [47094] (1 superfamily)
  4. 151016Superfamily a.21.1: HMG-box [47095] (1 family) (S)
  5. 151017Family a.21.1.1: HMG-box [47096] (8 proteins)
  6. 151024Protein HMG1, domains A and B [47097] (2 species)
  7. 151025Species Hamster (Cricetulus griseus) [TaxId:10029] [47099] (4 PDB entries)
  8. 151027Domain d1nhm__: 1nhm - [16422]

Details for d1nhm__

PDB Entry: 1nhm (more details)

PDB Description: the structure of the hmg box and its interaction with dna

SCOP Domain Sequences for d1nhm__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhm__ a.21.1.1 (-) HMG1, domains A and B {Hamster (Cricetulus griseus)}
napkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekkaaklk
ekyekdiaayrakgkpdaa

SCOP Domain Coordinates for d1nhm__:

Click to download the PDB-style file with coordinates for d1nhm__.
(The format of our PDB-style files is described here.)

Timeline for d1nhm__: