Lineage for d2eyha_ (2eyh A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 949213Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 949214Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 949215Protein Staphylococcal nuclease [50201] (1 species)
  7. 949216Species Staphylococcus aureus [TaxId:1280] [50202] (147 PDB entries)
    Uniprot P00644 89-223
  8. 949316Domain d2eyha_: 2eyh A: [164218]
    automated match to d1joka_
    mutant

Details for d2eyha_

PDB Entry: 2eyh (more details), 1.9 Å

PDB Description: crystal structure of staphylococcal nuclease mutant t62s
PDB Compounds: (A:) staphylococcal nuclease

SCOPe Domain Sequences for d2eyha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eyha_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasafskkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
kseaqakkeklniws

SCOPe Domain Coordinates for d2eyha_:

Click to download the PDB-style file with coordinates for d2eyha_.
(The format of our PDB-style files is described here.)

Timeline for d2eyha_: