SCOPe 2.05: Domain d2ey6a_: 2ey6 A:

Lineage for d2ey6a_ (2ey6 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family)

5. Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Staphylococcal nuclease [50201] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50202] (227 PDB entries)
   Uniprot P00644 89-223

8. Domain d2ey6a_: 2ey6 A: [164216]
   automated match to d1joka_
   mutant

Details for d2ey6a_

PDB Entry: 2ey6, 1.65 Å

PDB Description: crystal structure of staphylococcal nuclease mutant t41v

PDB Compounds: (A:) staphylococcal nuclease

SCOPe Domain Sequences for d2ey6a_:

Sequence; same for both SEQRES and ATOM records:

>d2ey6a_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdvpetkhpkkgvekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
kseaqakkeklniws

Timeline for d2ey6a_:

• d2ey6a_ first appeared in SCOPe 2.01
  
• d2ey6a_ appears in SCOPe 2.04
  
• d2ey6a_ appears in SCOPe 2.06
  
• d2ey6a_ appears in the current release, SCOPe 2.08