SCOPe 2.05: Domain d2exvc_: 2exv C:

Lineage for d2exvc_ (2exv C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein automated matches [190113] (15 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187678] (1 PDB entry)

8. Domain d2exvc_: 2exv C: [164211]
   automated match to d1dvva_
   complexed with acy, hec; mutant

Details for d2exvc_

PDB Entry: 2exv, 1.86 Å

PDB Description: crystal structure of the f7a mutant of the cytochrome c551 from pseudomonas aeruginosa

PDB Compounds: (C:) cytochrome c-551

SCOPe Domain Sequences for d2exvc_:

Sequence; same for both SEQRES and ATOM records:

>d2exvc_ a.3.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dpevlaknkgcvachaidtkmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpipm
ppnavsddeaqtlakwvlsqk

Timeline for d2exvc_:

• d2exvc_ first appeared in SCOPe 2.01
  
• d2exvc_ appears in SCOPe 2.04
  
• d2exvc_ appears in SCOPe 2.06
  
• d2exvc_ appears in the current release, SCOPe 2.08