Lineage for d2exva_ (2exv A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691317Protein automated matches [190113] (17 species)
    not a true protein
  7. 2691371Species Pseudomonas aeruginosa [TaxId:287] [187678] (1 PDB entry)
  8. 2691372Domain d2exva_: 2exv A: [164210]
    automated match to d1dvva_
    complexed with acy, hec; mutant

Details for d2exva_

PDB Entry: 2exv (more details), 1.86 Å

PDB Description: crystal structure of the f7a mutant of the cytochrome c551 from pseudomonas aeruginosa
PDB Compounds: (A:) cytochrome c-551

SCOPe Domain Sequences for d2exva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exva_ a.3.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
edpevlaknkgcvachaidtkmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpip
mppnavsddeaqtlakwvlsqk

SCOPe Domain Coordinates for d2exva_:

Click to download the PDB-style file with coordinates for d2exva_.
(The format of our PDB-style files is described here.)

Timeline for d2exva_: