| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
| Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
| Protein Cytochrome c3 [48697] (7 species) contains four heme groups |
| Species Desulfovibrio vulgaris [TaxId:881] [48699] (18 PDB entries) Uniprot P00132 |
| Domain d2ewka_: 2ewk A: [164205] automated match to d1it1a_ complexed with hem; mutant |
PDB Entry: 2ewk (more details), 1 Å
SCOPe Domain Sequences for d2ewka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ewka_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio vulgaris [TaxId: 881]}
apkapadglkmdktkqpvvfnhsvhkavkcgdchhpvngkedyqkcatagchdnmdkkdk
sakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs
Timeline for d2ewka_: