SCOPe 2.05: Domain d2evwx_: 2evw X:

Lineage for d2evwx_ (2evw X:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (109 PDB entries)
   Uniprot Q6P716

8. Domain d2evwx_: 2evw X: [164203]
   automated match to d1aa9a_
   complexed with cag, mg, xy2

Details for d2evwx_

PDB Entry: 2evw, 1.05 Å

PDB Description: crystal structure analysis of a fluorescent form of h-ras p21 in complex with r-caged gtp

PDB Compounds: (X:) gtpase hras

SCOPe Domain Sequences for d2evwx_:

Sequence; same for both SEQRES and ATOM records:

>d2evwx_ c.37.1.8 (X:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdecdptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnksdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d2evwx_:

• d2evwx_ first appeared in SCOPe 2.01
  
• d2evwx_ appears in SCOPe 2.04
  
• d2evwx_ appears in SCOPe 2.06
  
• d2evwx_ appears in the current release, SCOPe 2.08