Lineage for d2evta_ (2evt A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2350805Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
    multihelical; 2 layers or orthogonally packed helices
  4. 2350806Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) (S)
  5. 2350807Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins)
  6. 2350838Protein automated matches [190530] (2 species)
    not a true protein
  7. 2350842Species Human (Homo sapiens) [TaxId:9606] [187675] (1 PDB entry)
  8. 2350843Domain d2evta_: 2evt A: [164201]
    automated match to d1sx6a_
    complexed with hex; mutant

Details for d2evta_

PDB Entry: 2evt (more details), 1.99 Å

PDB Description: crystal structure of d48v mutant of human glycolipid transfer protein
PDB Compounds: (A:) glycolipid transfer protein

SCOPe Domain Sequences for d2evta_:

Sequence, based on SEQRES records: (download)

>d2evta_ a.224.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aehllkplpadkqietgpfleavshlppffdclgspvftpikavisgnitkikavydtnp
akfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnli
rvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlfl
vnytatidviyemytqmnaelnykv

Sequence, based on observed residues (ATOM records): (download)

>d2evta_ a.224.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aehllkplpadkqietgpfleavshlppffdclgspvftpikavisgnitkikavydtnp
akfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnli
rvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskteeeclekirlflvnyt
atidviyemytqmnaelnykv

SCOPe Domain Coordinates for d2evta_:

Click to download the PDB-style file with coordinates for d2evta_.
(The format of our PDB-style files is described here.)

Timeline for d2evta_: