![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily) multihelical; 2 layers or orthogonally packed helices |
![]() | Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) ![]() |
![]() | Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins) |
![]() | Protein automated matches [190530] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187675] (1 PDB entry) |
![]() | Domain d2evta_: 2evt A: [164201] automated match to d1sx6a_ complexed with hex; mutant |
PDB Entry: 2evt (more details), 1.99 Å
SCOPe Domain Sequences for d2evta_:
Sequence, based on SEQRES records: (download)
>d2evta_ a.224.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aehllkplpadkqietgpfleavshlppffdclgspvftpikavisgnitkikavydtnp akfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnli rvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlfl vnytatidviyemytqmnaelnykv
>d2evta_ a.224.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aehllkplpadkqietgpfleavshlppffdclgspvftpikavisgnitkikavydtnp akfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnli rvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskteeeclekirlflvnyt atidviyemytqmnaelnykv
Timeline for d2evta_: