SCOPe 2.06: Domain d2esua_: 2esu A:

Lineage for d2esua_ (2esu A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
   automatically mapped to Pfam PF00197

6. Protein automated matches [190504] (2 species)
   not a true protein

7. Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [187454] (12 PDB entries)

8. Domain d2esua_: 2esu A: [164199]
   automated match to d1wbca_
   complexed with ni, so4; mutant

Details for d2esua_

PDB Entry: 2esu, 1.94 Å

PDB Description: crystal structure of asn to gln mutant of winged bean chymotrypsin inhibitor protein

PDB Compounds: (A:) Chymotrypsin inhibitor 3

SCOPe Domain Sequences for d2esua_:

Sequence; same for both SEQRES and ATOM records:

>d2esua_ b.42.4.1 (A:) automated matches {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dlvdaegnlveqggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiriss
qflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfekv
shsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllka

Timeline for d2esua_:

• d2esua_ first appeared in SCOPe 2.01
  
• d2esua_ appears in SCOPe 2.05
  
• d2esua_ appears in SCOPe 2.07
  
• d2esua_ appears in the current release, SCOPe 2.08