Lineage for d2esdb_ (2esd B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2908568Family c.82.1.1: ALDH-like [53721] (6 proteins)
  6. 2908891Protein automated matches [190401] (5 species)
    not a true protein
  7. 2908969Species Streptococcus mutans [TaxId:1309] [187673] (3 PDB entries)
  8. 2908979Domain d2esdb_: 2esd B: [164196]
    automated match to d1euha_
    complexed with g3h, nap

Details for d2esdb_

PDB Entry: 2esd (more details), 2.55 Å

PDB Description: crystal structure of thioacylenzyme intermediate of an nadp dependent aldehyde dehydrogenase
PDB Compounds: (B:) NADP-dependent glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2esdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esdb_ c.82.1.1 (B:) automated matches {Streptococcus mutans [TaxId: 1309]}
tkqyknyvngewklseneikiyepasgaelgsvpamsteevdyvyasakkaqpawralsy
ieraaylhkvadilmrdkekigailskevakgyksavsevvrtaeiinyaaeeglrmege
vleggsfeaaskkkiavvrrepvglvlaispfnypvnlagskiapaliagnviafkpptq
gsisglllaeafaeaglpagvfntitgrgseigdyivehqavnfinftgstgigerigkm
agmrpimlalggkdsaivledadleltakniiagafgysgqrctavkrvlvmesvadelv
ekirekvlaltignpeddaditplidtksadyveglindandkgatalteikregnlicp
ilfdkvttdmrlaweepfgpvlpiirvtsveeaieisnkseyglqasiftndfprafgia
eqlevgtvhinnktqrgtdnfpflgakksgagiqgvkysieamttvksvvfdik

SCOPe Domain Coordinates for d2esdb_:

Click to download the PDB-style file with coordinates for d2esdb_.
(The format of our PDB-style files is described here.)

Timeline for d2esdb_: