Lineage for d2esda_ (2esd A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2908568Family c.82.1.1: ALDH-like [53721] (6 proteins)
  6. 2908891Protein automated matches [190401] (5 species)
    not a true protein
  7. 2908969Species Streptococcus mutans [TaxId:1309] [187673] (3 PDB entries)
  8. 2908978Domain d2esda_: 2esd A: [164195]
    automated match to d1euha_
    complexed with g3h, nap

Details for d2esda_

PDB Entry: 2esd (more details), 2.55 Å

PDB Description: crystal structure of thioacylenzyme intermediate of an nadp dependent aldehyde dehydrogenase
PDB Compounds: (A:) NADP-dependent glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2esda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esda_ c.82.1.1 (A:) automated matches {Streptococcus mutans [TaxId: 1309]}
tkqyknyvngewklseneikiyepasgaelgsvpamsteevdyvyasakkaqpawralsy
ieraaylhkvadilmrdkekigailskevakgyksavsevvrtaeiinyaaeeglrmege
vleggsfeaaskkkiavvrrepvglvlaispfnypvnlagskiapaliagnviafkpptq
gsisglllaeafaeaglpagvfntitgrgseigdyivehqavnfinftgstgigerigkm
agmrpimlalggkdsaivledadleltakniiagafgysgqrctavkrvlvmesvadelv
ekirekvlaltignpeddaditplidtksadyveglindandkgatalteikregnlicp
ilfdkvttdmrlaweepfgpvlpiirvtsveeaieisnkseyglqasiftndfprafgia
eqlevgtvhinnktqrgtdnfpflgakksgagiqgvkysieamttvksvvfdik

SCOPe Domain Coordinates for d2esda_:

Click to download the PDB-style file with coordinates for d2esda_.
(The format of our PDB-style files is described here.)

Timeline for d2esda_: