SCOP 1.69: Domain d1hmf__: 1hmf -

Lineage for d1hmf__ (1hmf -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (1 family)

5. Family a.21.1.1: HMG-box [47096] (9 proteins)

6. Protein High mobility group protein 1, HMG1 [47097] (2 species)
   duplication: contains HMG-box domains

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47098] (4 PDB entries)

8. Domain d1hmf__: 1hmf - [16419]
   domain B

Details for d1hmf__

PDB Entry: 1hmf

PDB Description: structure of the hmg box motif in the b-domain of hmg1

SCOP Domain Sequences for d1hmf__:

Sequence; same for both SEQRES and ATOM records:

>d1hmf__ a.21.1.1 (-) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus)}
fkdpnapkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekka
aklkekyekdiaayrak

Timeline for d1hmf__:

• d1hmf__ first appeared (with stable ids) in SCOP 1.55
  
• d1hmf__ appears in SCOP 1.67
  
• d1hmf__ appears in SCOP 1.71
  
• d1hmf__ appears in the current release, SCOPe 2.08, called d1hmfa_