Lineage for d2eo0b_ (2eo0 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371642Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1371643Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1371870Family c.52.1.18: Hjc-like [64080] (3 proteins)
    Pfam PF01870
  6. 1371886Protein automated matches [190866] (1 species)
    not a true protein
  7. 1371887Species Sulfolobus tokodaii [TaxId:273063] [188210] (1 PDB entry)
  8. 1371889Domain d2eo0b_: 2eo0 B: [164180]
    automated match to d1hh1a_

Details for d2eo0b_

PDB Entry: 2eo0 (more details), 2.4 Å

PDB Description: Crystal Structure of Holliday Junction Resolvase ST1444
PDB Compounds: (B:) Hypothetical protein ST1444

SCOPe Domain Sequences for d2eo0b_:

Sequence, based on SEQRES records: (download)

>d2eo0b_ c.52.1.18 (B:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
ssveryivsrlrdkgfavirapasgskrkdhvpdiialksgviilievksrkngqkiyie
keqaegirefakrsggelflgvklpkmlrfikfdmlrqteggnyaidletvekgmeledl
vryveskisrtlds

Sequence, based on observed residues (ATOM records): (download)

>d2eo0b_ c.52.1.18 (B:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
ssveryivsrlrdkgfavirarkdhvpdiialksgviilievksrkiyiekeqaegiref
akrsggelflgvklpkmlrfikfdmlrqteggnyaidletvekgmeledlvryveskisr
tlds

SCOPe Domain Coordinates for d2eo0b_:

Click to download the PDB-style file with coordinates for d2eo0b_.
(The format of our PDB-style files is described here.)

Timeline for d2eo0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2eo0a_