![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) ![]() |
![]() | Family c.52.1.18: Hjc-like [64080] (3 proteins) Pfam PF01870 |
![]() | Protein automated matches [190866] (1 species) not a true protein |
![]() | Species Sulfolobus tokodaii [TaxId:273063] [188210] (1 PDB entry) |
![]() | Domain d2eo0b_: 2eo0 B: [164180] automated match to d1hh1a_ |
PDB Entry: 2eo0 (more details), 2.4 Å
SCOPe Domain Sequences for d2eo0b_:
Sequence, based on SEQRES records: (download)
>d2eo0b_ c.52.1.18 (B:) automated matches {Sulfolobus tokodaii [TaxId: 273063]} ssveryivsrlrdkgfavirapasgskrkdhvpdiialksgviilievksrkngqkiyie keqaegirefakrsggelflgvklpkmlrfikfdmlrqteggnyaidletvekgmeledl vryveskisrtlds
>d2eo0b_ c.52.1.18 (B:) automated matches {Sulfolobus tokodaii [TaxId: 273063]} ssveryivsrlrdkgfavirarkdhvpdiialksgviilievksrkiyiekeqaegiref akrsggelflgvklpkmlrfikfdmlrqteggnyaidletvekgmeledlvryveskisr tlds
Timeline for d2eo0b_: