SCOP 1.65: Domain d1hme__: 1hme -

Lineage for d1hme__ (1hme -)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (1 family)

5. Family a.21.1.1: HMG-box [47096] (8 proteins)

6. Protein HMG1, domains A and B [47097] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47098] (4 PDB entries)

8. Domain d1hme__: 1hme - [16418]
   domain B

Details for d1hme__

PDB Entry: 1hme

PDB Description: structure of the hmg box motif in the b-domain of hmg1

SCOP Domain Sequences for d1hme__:

Sequence; same for both SEQRES and ATOM records:

>d1hme__ a.21.1.1 (-) HMG1, domains A and B {Rat (Rattus norvegicus)}
fkdpnapkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekka
aklkekyekdiaayrak

Timeline for d1hme__:

• d1hme__ first appeared (with stable ids) in SCOP 1.55
  
• d1hme__ appears in SCOP 1.63
  
• d1hme__ appears in SCOP 1.67
  
• d1hme__ appears in the current release, SCOPe 2.08, called d1hmea_