Lineage for d1hmea_ (1hme A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697956Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2697957Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2697958Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 2697959Protein High mobility group protein 1, HMG1 [47097] (2 species)
    duplication: contains HMG-box domains
  7. 2697966Species Norway rat (Rattus norvegicus) [TaxId:10116] [47098] (4 PDB entries)
  8. 2697968Domain d1hmea_: 1hme A: [16418]
    domain B

Details for d1hmea_

PDB Entry: 1hme (more details)

PDB Description: structure of the hmg box motif in the b-domain of hmg1
PDB Compounds: (A:) high mobility group protein fragment-b

SCOPe Domain Sequences for d1hmea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hmea_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fkdpnapkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekka
aklkekyekdiaayrak

SCOPe Domain Coordinates for d1hmea_:

Click to download the PDB-style file with coordinates for d1hmea_.
(The format of our PDB-style files is described here.)

Timeline for d1hmea_: