SCOPe 2.06: Domain d2eo0a_: 2eo0 A:

Lineage for d2eo0a_ (2eo0 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families)

5. Family c.52.1.18: Hjc-like [64080] (3 proteins)
   Pfam PF01870

6. Protein automated matches [190866] (2 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [188210] (1 PDB entry)

8. Domain d2eo0a_: 2eo0 A: [164179]
   automated match to d1hh1a_

Details for d2eo0a_

PDB Entry: 2eo0, 2.4 Å

PDB Description: Crystal Structure of Holliday Junction Resolvase ST1444

PDB Compounds: (A:) Hypothetical protein ST1444

SCOPe Domain Sequences for d2eo0a_:

Sequence, based on SEQRES records:

>d2eo0a_ c.52.1.18 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
ssveryivsrlrdkgfavirapasgskrkdhvpdiialksgviilievksrkngqkiyie
keqaegirefakrsggelflgvklpkmlrfikfdmlrqteggnyaidletvekgmeledl
vryveskisrtldsfl

Sequence, based on observed residues (ATOM records):

>d2eo0a_ c.52.1.18 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
ssveryivsrlrdkgfavirakrkdhvpdiialksgviilievksrkngkiyiekeqaeg
irefakrsggelflgvklpkmlrfikfdmlrqteggnyaidletvekgmeledlvryves
kisrtldsfl

Timeline for d2eo0a_:

• d2eo0a_ first appeared in SCOPe 2.01
  
• d2eo0a_ appears in SCOPe 2.05
  
• d2eo0a_ appears in SCOPe 2.07
  
• d2eo0a_ appears in the current release, SCOPe 2.08