SCOPe 2.08: Domain d2enxb_: 2enx B:

Lineage for d2enxb_ (2enx B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 6 strands, order 321456
   Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest

4. Superfamily c.107.1: DHH phosphoesterases [64182] (3 families)
   constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains

5. Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (2 proteins)

6. Protein automated matches [190947] (2 species)
   not a true protein

7. Species Streptococcus agalactiae [TaxId:205921] [188543] (1 PDB entry)

8. Domain d2enxb_: 2enx B: [164178]
   automated match to d1wppa_
   complexed with 2pn, mg, mn, trp

Details for d2enxb_

PDB Entry: 2enx, 2.8 Å

PDB Description: Structure of the family II inorganic pyrophosphatase from Streptococcus agalactiae at 2.8 resolution

PDB Compounds: (B:) Manganese-dependent inorganic pyrophosphatase

SCOPe Domain Sequences for d2enxb_:

Sequence; same for both SEQRES and ATOM records:

>d2enxb_ c.107.1.1 (B:) automated matches {Streptococcus agalactiae [TaxId: 205921]}
skilvfghqnpdsdaigssvafaylakeawgldteavalgtpneetayvldyfgvqaprv
vesakaegvetviltdhnefqqsisdikdvtvygvvdhhrvanfetanplymrlepvgsa
ssivyrmfkengvsvpkelaglllsglisdtlllksptthasdipvakelaelagvnlee
yglemlkagtnlssktaaelididaktfelngeavrvaqvntvdindilarqeeievaiq
eaivtegysdfvlmitdivnsnseilalgsnmakveaafeftlennhaflagavsrkkqv
vpqltesyna

Timeline for d2enxb_:

• d2enxb_ first appeared in SCOPe 2.01
  
• d2enxb_ appears in SCOPe 2.07