Lineage for d1ckta_ (1ckt A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2075Fold a.21: HMG-box [47094] (1 superfamily)
  4. 2076Superfamily a.21.1: HMG-box [47095] (1 family) (S)
  5. 2077Family a.21.1.1: HMG-box [47096] (7 proteins)
  6. 2083Protein HMG1, domains A and B [47097] (2 species)
  7. 2089Species Rat (Rattus norvegicus) [TaxId:10116] [47098] (4 PDB entries)
  8. 2090Domain d1ckta_: 1ckt A: [16417]

Details for d1ckta_

PDB Entry: 1ckt (more details), 2.5 Å

PDB Description: crystal structure of hmg1 domain a bound to a cisplatin-modified dna duplex

SCOP Domain Sequences for d1ckta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckta_ a.21.1.1 (A:) HMG1, domains A and B {Rat (Rattus norvegicus)}
kprgkmssyaffvqtcreehkkkhpdasvnfsefskkcserwktmsakekgkfedmakad
karyeremkty

SCOP Domain Coordinates for d1ckta_:

Click to download the PDB-style file with coordinates for d1ckta_.
(The format of our PDB-style files is described here.)

Timeline for d1ckta_: