Class a: All alpha proteins [46456] (290 folds) |
Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
Superfamily a.21.1: HMG-box [47095] (2 families) |
Family a.21.1.1: HMG-box [47096] (10 proteins) |
Protein High mobility group protein 1, HMG1 [47097] (2 species) duplication: contains HMG-box domains |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [47098] (4 PDB entries) |
Domain d1ckta_: 1ckt A: [16417] domain A protein/DNA complex; complexed with cpt |
PDB Entry: 1ckt (more details), 2.5 Å
SCOPe Domain Sequences for d1ckta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} kprgkmssyaffvqtcreehkkkhpdasvnfsefskkcserwktmsakekgkfedmakad karyeremkty
Timeline for d1ckta_: