Lineage for d1ckta_ (1ckt A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697956Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2697957Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2697958Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 2697959Protein High mobility group protein 1, HMG1 [47097] (2 species)
    duplication: contains HMG-box domains
  7. 2697966Species Norway rat (Rattus norvegicus) [TaxId:10116] [47098] (4 PDB entries)
  8. 2697967Domain d1ckta_: 1ckt A: [16417]
    domain A
    protein/DNA complex; complexed with cpt

Details for d1ckta_

PDB Entry: 1ckt (more details), 2.5 Å

PDB Description: crystal structure of hmg1 domain a bound to a cisplatin-modified dna duplex
PDB Compounds: (A:) high mobility group 1 protein

SCOPe Domain Sequences for d1ckta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kprgkmssyaffvqtcreehkkkhpdasvnfsefskkcserwktmsakekgkfedmakad
karyeremkty

SCOPe Domain Coordinates for d1ckta_:

Click to download the PDB-style file with coordinates for d1ckta_.
(The format of our PDB-style files is described here.)

Timeline for d1ckta_: