![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
![]() | Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
![]() | Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
![]() | Protein automated matches [190627] (4 species) not a true protein |
![]() | Species Geobacillus kaustophilus [TaxId:235909] [188209] (1 PDB entry) |
![]() | Domain d2emqa_: 2emq A: [164163] automated match to d1yava3 |
PDB Entry: 2emq (more details), 2.5 Å
SCOPe Domain Sequences for d2emqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2emqa_ d.37.1.1 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]} qmtvkpflipadkvahvqpgnyldhallvltktgysaipvldtsyklhglismtmmmdai lglerieferletmkveevmnrniprlrlddslmkavglivnhpfvcvenddgyfagift rrevlkqlnkqlhrp
Timeline for d2emqa_: