SCOPe 2.08: Domain d2emqa_: 2emq A:

Lineage for d2emqa_ (2emq A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein automated matches [190627] (7 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:235909] [188209] (1 PDB entry)

8. Domain d2emqa_: 2emq A: [164163]
   automated match to d1yava3

Details for d2emqa_

PDB Entry: 2emq, 2.5 Å

PDB Description: hypothetical conserved protein (gk1048) from geobacillus kaustophilus

PDB Compounds: (A:) Hypothetical conserved protein

SCOPe Domain Sequences for d2emqa_:

Sequence; same for both SEQRES and ATOM records:

>d2emqa_ d.37.1.1 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
qmtvkpflipadkvahvqpgnyldhallvltktgysaipvldtsyklhglismtmmmdai
lglerieferletmkveevmnrniprlrlddslmkavglivnhpfvcvenddgyfagift
rrevlkqlnkqlhrp

Timeline for d2emqa_:

• d2emqa_ first appeared in SCOPe 2.01
  
• d2emqa_ appears in SCOPe 2.07