SCOPe 2.06: Domain d1lbua1: 1lbu A:1-83

Lineage for d1lbua1 (1lbu A:1-83)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.20: PGBD-like [47089] (1 superfamily)
   core: 3 helices; bundle, closed, left-handed twist; parallel

4. Superfamily a.20.1: PGBD-like [47090] (3 families)

5. Family a.20.1.1: Peptidoglycan binding domain, PGBD [47091] (2 proteins)

6. Protein Zn2+ DD-carboxypeptidase, N-terminal domain [47092] (1 species)
   probable peptidoglycan-binding domain

7. Species Streptomyces albus G [TaxId:1962] [47093] (1 PDB entry)

8. Domain d1lbua1: 1lbu A:1-83 [16416]
   Other proteins in same PDB: d1lbua2
   complexed with zn

Details for d1lbua1

PDB Entry: 1lbu, 1.8 Å

PDB Description: hydrolase metallo (zn) dd-peptidase

PDB Compounds: (A:) muramoyl-pentapeptide carboxypeptidase

SCOPe Domain Sequences for d1lbua1:

Sequence; same for both SEQRES and ATOM records:

>d1lbua1 a.20.1.1 (A:1-83) Zn2+ DD-carboxypeptidase, N-terminal domain {Streptomyces albus G [TaxId: 1962]}
dgcytwsgtlsegssgeavrqlqirvagypgtgaqlaidgqfgpatkaavqrfqsaygla
adgiagpatfnkiyqlqdddctp

Timeline for d1lbua1:

• d1lbua1 first appeared (with stable ids) in SCOP 1.55, called d1lbu_1
  
• d1lbua1 appears in SCOPe 2.05
  
• d1lbua1 appears in SCOPe 2.07
  
• d1lbua1 appears in the current release, SCOPe 2.08