Class a: All alpha proteins [46456] (289 folds) |
Fold a.20: PGBD-like [47089] (1 superfamily) core: 3 helices; bundle, closed, left-handed twist; parallel |
Superfamily a.20.1: PGBD-like [47090] (3 families) |
Family a.20.1.1: Peptidoglycan binding domain, PGBD [47091] (2 proteins) |
Protein Zn2+ DD-carboxypeptidase, N-terminal domain [47092] (1 species) probable peptidoglycan-binding domain |
Species Streptomyces albus G [TaxId:1962] [47093] (1 PDB entry) |
Domain d1lbua1: 1lbu A:1-83 [16416] Other proteins in same PDB: d1lbua2 complexed with zn |
PDB Entry: 1lbu (more details), 1.8 Å
SCOPe Domain Sequences for d1lbua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lbua1 a.20.1.1 (A:1-83) Zn2+ DD-carboxypeptidase, N-terminal domain {Streptomyces albus G [TaxId: 1962]} dgcytwsgtlsegssgeavrqlqirvagypgtgaqlaidgqfgpatkaavqrfqsaygla adgiagpatfnkiyqlqdddctp
Timeline for d1lbua1: