Lineage for d2el7b_ (2el7 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105469Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species)
    overall structure is similar to TyrRS
  7. 2105555Species Thermus thermophilus HB8 [TaxId:300852] [188378] (1 PDB entry)
  8. 2105557Domain d2el7b_: 2el7 B: [164158]
    automated match to d1i6ka_
    complexed with po4

Details for d2el7b_

PDB Entry: 2el7 (more details), 2.5 Å

PDB Description: Crystal structure of Tryptophanyl-tRNA synthetase from Thermus thermophilus
PDB Compounds: (B:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d2el7b_:

Sequence, based on SEQRES records: (download)

>d2el7b_ c.26.1.1 (B:) Tryptophanyl-tRNA synthetase (TrpRS) {Thermus thermophilus HB8 [TaxId: 300852]}
mkrvlsgiqpsgeihignylgaikqwvaigeklgrdaffcivdyhaltnplaydpstlaq
rtfeaalvniaagldpekvtlfvqshvpehtelswvfttltplgdltrmtqfkdkaskqe
tvwsgllmypvlqaadiliykadtvpvgedqvqhieltreiarrfnhlfgetfpepqall
npeaprvpgidgkakmskslgntigllepeesiwqkiqhlpddpqrirlsdpgdpertil
ftylsyfapkdlvealkeeyrkagvgtyvvkrilfdhlmealrpireraealkkdpdyvm
dallegakraravaqatmeevrekvglllp

Sequence, based on observed residues (ATOM records): (download)

>d2el7b_ c.26.1.1 (B:) Tryptophanyl-tRNA synthetase (TrpRS) {Thermus thermophilus HB8 [TaxId: 300852]}
mkrvlsgiqpsgeihignylgaikqwvaigeklgrdaffcivdyhaltnplaydpstlaq
rtfeaalvniaagldpekvtlfvqshvpehtelswvfttltplgdltrmtqfkdkaskqe
tvwsgllmypvlqaadiliykadtvpvgedqvqhieltreiarrfnhlfgetfpepqall
npeaprvpgidgkakmskslgntigllepeesiwqkiqhlpddtilftylsyfapkdlve
alkeeyrkagvgtyvvkrilfdhlmealrpireraealkkdpdyvmdallegakrarava
qatmeevrekvglllp

SCOPe Domain Coordinates for d2el7b_:

Click to download the PDB-style file with coordinates for d2el7b_.
(The format of our PDB-style files is described here.)

Timeline for d2el7b_: