Lineage for d1gaka_ (1gak A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725530Fold a.19: Fertilization protein [47081] (1 superfamily)
    core: 3 helices; bundle, closed, right-handed twist; up-and-down
  4. 1725531Superfamily a.19.1: Fertilization protein [47082] (1 family) (S)
    automatically mapped to Pfam PF01303
  5. 1725532Family a.19.1.1: Fertilization protein [47083] (2 proteins)
  6. 1725546Protein SP18 [47087] (1 species)
  7. 1725547Species Green abalone (Haliotis fulgens) [TaxId:6456] [47088] (1 PDB entry)
  8. 1725548Domain d1gaka_: 1gak A: [16415]
    CASP4

Details for d1gaka_

PDB Entry: 1gak (more details), 1.85 Å

PDB Description: crystal structure of green abalone sp18
PDB Compounds: (A:) fertilization protein

SCOPe Domain Sequences for d1gaka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaka_ a.19.1.1 (A:) SP18 {Green abalone (Haliotis fulgens) [TaxId: 6456]}
fddvvvsrqeqsyvqrgmvnfldeemhklvkrfrdmrwnlgpgfvfllkkvnrermmryc
mdyaryskkilqlkhlpvnkktltkmgrfvgyrnygvirelyadvfrdvqgfrgpkmtaa
mrkysskdpgtfpckne

SCOPe Domain Coordinates for d1gaka_:

Click to download the PDB-style file with coordinates for d1gaka_.
(The format of our PDB-style files is described here.)

Timeline for d1gaka_: