![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
![]() | Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
![]() | Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) |
![]() | Protein automated matches [190196] (7 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [187129] (15 PDB entries) |
![]() | Domain d2ekza_: 2ekz A: [164147] automated match to d1v37a_ |
PDB Entry: 2ekz (more details), 1.85 Å
SCOPe Domain Sequences for d2ekza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ekza_ c.60.1.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdmlrarrtae lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlald
Timeline for d2ekza_: