Lineage for d2ekyh_ (2eky H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955711Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) (S)
  5. 2955748Family d.58.48.0: automated matches [191332] (1 protein)
    not a true family
  6. 2955749Protein automated matches [190160] (2 species)
    not a true protein
  7. 2955752Species Methanocaldococcus jannaschii [TaxId:243232] [188208] (2 PDB entries)
  8. 2955764Domain d2ekyh_: 2eky H: [164146]
    automated match to d1lxna_

Details for d2ekyh_

PDB Entry: 2eky (more details), 1.8 Å

PDB Description: Crystal Structure of hypothetical protein MJ1052 from Methanocaldococcus jannaschii (Form 1)
PDB Compounds: (H:) UPF0045 protein MJ1052

SCOPe Domain Sequences for d2ekyh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ekyh_ d.58.48.0 (H:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mrkvvaevsiiplgkgasvskyvkkaievfkkydlkvetnamgtvlegdldeilkafkea
hstvlndvdrvvsslkiderkdkentierklkaige

SCOPe Domain Coordinates for d2ekyh_:

Click to download the PDB-style file with coordinates for d2ekyh_.
(The format of our PDB-style files is described here.)

Timeline for d2ekyh_: