Lineage for d3lynb_ (3lyn B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46243Fold a.19: Fertilization protein [47081] (1 superfamily)
  4. 46244Superfamily a.19.1: Fertilization protein [47082] (1 family) (S)
  5. 46245Family a.19.1.1: Fertilization protein [47083] (2 proteins)
  6. 46246Protein Lysin [47084] (2 species)
  7. 46247Species Green abalone (Haliotis fulgens) [TaxId:6456] [47086] (1 PDB entry)
  8. 46249Domain d3lynb_: 3lyn B: [16414]

Details for d3lynb_

PDB Entry: 3lyn (more details), 1.7 Å

PDB Description: structure of green abalone lysin dimer

SCOP Domain Sequences for d3lynb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lynb_ a.19.1.1 (B:) Lysin {Green abalone (Haliotis fulgens)}
inkayevtmkiqiisgfdrqltawlrvhgrrltnnqkktlffvnrrymqthwqnymlwvk
rkikalgrpaavgdytrlgaeigrrvdmvffynflsgrkmippysaymaklnalrpadvp
vknh

SCOP Domain Coordinates for d3lynb_:

Click to download the PDB-style file with coordinates for d3lynb_.
(The format of our PDB-style files is described here.)

Timeline for d3lynb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3lyna_