Lineage for d2ekqc_ (2ekq C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978249Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 978250Protein automated matches [190069] (51 species)
    not a true protein
  7. 978511Species Thermus thermophilus [TaxId:300852] [187989] (5 PDB entries)
  8. 978515Domain d2ekqc_: 2ekq C: [164137]
    automated match to d1vl8a_
    complexed with gol, so4

Details for d2ekqc_

PDB Entry: 2ekq (more details), 1.8 Å

PDB Description: Structure of TT0495 protein from Thermus thermophilus
PDB Compounds: (C:) 2-deoxy-D-gluconate 3-dehydrogenase

SCOPe Domain Sequences for d2ekqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ekqc_ c.2.1.0 (C:) automated matches {Thermus thermophilus [TaxId: 300852]}
erkalvtggsrgigraiaealvargyrvaiasrnpeeaaqslgavplptdlekddpkglv
kralealgglhvlvhaaavnvrkpalelsyeewrrvlylhldvafllaqaaaphmaeagw
grvlfigsvttftaggpvpipayttaktallgltralakewarlgirvnllcpgyvetef
tlplrqnpelyepitaripmgrwarpeeiarvaavlcgdeaeyltgqavavdggflay

SCOPe Domain Coordinates for d2ekqc_:

Click to download the PDB-style file with coordinates for d2ekqc_.
(The format of our PDB-style files is described here.)

Timeline for d2ekqc_: