Lineage for d3lyna_ (3lyn A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.19: Fertilization protein [47081] (1 superfamily) Superfamily a.19.1: Fertilization protein [47082] (1 family) 
Family a.19.1.1: Fertilization protein [47083] (2 proteins) Protein Lysin [47084] (2 species) 
Species Green abalone (Haliotis fulgens) [TaxId:6456] [47086] (1 PDB entry) 
Domain d3lyna_: 3lyn A: [16413]
Details for d3lyna_
PDB Entry: 3lyn (more details), 1.7 Å
PDB Description: structure of green abalone lysin dimer
SCOP Domain Sequences for d3lyna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lyna_ a.19.1.1 (A:) Lysin {Green abalone (Haliotis fulgens)}
inkayevtmkiqiisgfdrqltawlrvhgrrltnnqkktlffvnrrymqthwqnymlwvk
rkikalgrpaavgdytrlgaeigrrvdmvffynflsgrkmippysaymaklnalrpadvp
vk
SCOP Domain Coordinates for d3lyna_:
Click to download the PDB-style file with coordinates for d3lyna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3lyna_:
- d3lyna_ appears in SCOP 1.57
- d3lyna_ appears in the current release, SCOPe 2.08
View in 3D
