Lineage for d3lyna_ (3lyn A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697878Fold a.19: Fertilization protein [47081] (1 superfamily)
    core: 3 helices; bundle, closed, right-handed twist; up-and-down
  4. 2697879Superfamily a.19.1: Fertilization protein [47082] (1 family) (S)
    automatically mapped to Pfam PF01303
  5. 2697880Family a.19.1.1: Fertilization protein [47083] (3 proteins)
  6. 2697881Protein Lysin [47084] (2 species)
  7. 2697882Species Green abalone (Haliotis fulgens) [TaxId:6456] [47086] (1 PDB entry)
  8. 2697883Domain d3lyna_: 3lyn A: [16413]

Details for d3lyna_

PDB Entry: 3lyn (more details), 1.7 Å

PDB Description: structure of green abalone lysin dimer
PDB Compounds: (A:) sperm lysin

SCOPe Domain Sequences for d3lyna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lyna_ a.19.1.1 (A:) Lysin {Green abalone (Haliotis fulgens) [TaxId: 6456]}
inkayevtmkiqiisgfdrqltawlrvhgrrltnnqkktlffvnrrymqthwqnymlwvk
rkikalgrpaavgdytrlgaeigrrvdmvffynflsgrkmippysaymaklnalrpadvp
vk

SCOPe Domain Coordinates for d3lyna_:

Click to download the PDB-style file with coordinates for d3lyna_.
(The format of our PDB-style files is described here.)

Timeline for d3lyna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3lynb_