SCOPe 2.01: Domain d2ek6c_: 2ek6 C:

Lineage for d2ek6c_ (2ek6 C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (9 PDB entries)

8. Domain d2ek6c_: 2ek6 C: [164123]
   automated match to d2cqpa1

Details for d2ek6c_

PDB Entry: 2ek6, 2.38 Å

PDB Description: crystal structure of human rna-binding protein 12

PDB Compounds: (C:) RNA-binding protein 12

SCOPe Domain Sequences for d2ek6c_:

Sequence; same for both SEQRES and ATOM records:

>d2ek6c_ d.58.7.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav
idlndrpigsrkvklsgp

Timeline for d2ek6c_:

• d2ek6c_ is new in SCOPe 2.01-stable
  
• d2ek6c_ appears in SCOPe 2.02
  
• d2ek6c_ appears in the current release, SCOPe 2.08, called d2ek6c1