Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein automated matches [190332] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187155] (9 PDB entries) |
Domain d2ek6b_: 2ek6 B: [164122] automated match to d2cqpa1 |
PDB Entry: 2ek6 (more details), 2.38 Å
SCOPe Domain Sequences for d2ek6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ek6b_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav idlndrpigsrkvklsgp
Timeline for d2ek6b_: