Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein automated matches [190332] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries) |
Domain d2ek6b1: 2ek6 B:13-87 [164122] Other proteins in same PDB: d2ek6a2, d2ek6b2, d2ek6c2, d2ek6d2 automated match to d2cqpa1 |
PDB Entry: 2ek6 (more details), 2.38 Å
SCOPe Domain Sequences for d2ek6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ek6b1 d.58.7.1 (B:13-87) automated matches {Human (Homo sapiens) [TaxId: 9606]} ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav idlndrpigsrkvkl
Timeline for d2ek6b1: