Lineage for d2ek6b1 (2ek6 B:13-87)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952339Protein automated matches [190332] (5 species)
    not a true protein
  7. 2952350Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries)
  8. 2952398Domain d2ek6b1: 2ek6 B:13-87 [164122]
    Other proteins in same PDB: d2ek6a2, d2ek6b2, d2ek6c2, d2ek6d2
    automated match to d2cqpa1

Details for d2ek6b1

PDB Entry: 2ek6 (more details), 2.38 Å

PDB Description: crystal structure of human rna-binding protein 12
PDB Compounds: (B:) RNA-binding protein 12

SCOPe Domain Sequences for d2ek6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ek6b1 d.58.7.1 (B:13-87) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav
idlndrpigsrkvkl

SCOPe Domain Coordinates for d2ek6b1:

Click to download the PDB-style file with coordinates for d2ek6b1.
(The format of our PDB-style files is described here.)

Timeline for d2ek6b1: